Sermorelin 5mg

Sermorelin Acetate 5mg - Premium Research Peptide

Sermorelin Acetate, available in 5mg quantities, is a highly specialized research peptide designed for advanced scientific studies, particularly in the fields of endocrinology and related areas. This product is ideal for laboratory settings where precision, reliability, and consistency are critical to achieving accurate results.

Product Specifications:

• Product Name: Sermorelin Acetate 5mg

• Molecular Formula: C149H246N44O42S

• Molecular Weight: 3358.9 g/mol

• Purity: ≥98%

• Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 (acetate salt)

• Form: Lyophilized Powder

Usage and Storage:
Sermorelin Acetate is supplied as a lyophilized powder to ensure maximum stability and ease of use in research applications. For optimal performance, detailed reconstitution and storage guidelines are available on our website.

Synthesis and Quality Assurance:
This peptide is synthesized through a meticulously controlled process to ensure high purity (≥98%) and stability, making it suitable for precise and reliable scientific research. Each batch undergoes rigorous quality control testing to meet the stringent standards required by researchers.

Legal and Safety Information:
This product is provided exclusively for scientific research purposes. It is not intended for human consumption, clinical use, or diagnostic applications. All products are manufactured and supplied in compliance with applicable legal and quality standards.

Important Notice: Our peptides are designed solely for research purposes. We kindly request that all inquiries and usage remain within the scope of scientific research.

For more information or to explore our range of high-quality research peptides, visit our website or contact our team. We are dedicated to supporting scientific innovation with reliable, premium-grade materials.